SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15893695|ref|NP_347044.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15893695|ref|NP_347044.1|
Domain Number 1 Region: 26-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-71
Family Protein kinases, catalytic subunit 0.0000306
Further Details:      
 
Domain Number 2 Region: 335-418,505-593
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000552
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15893695|ref|NP_347044.1|
Sequence length 657
Comment Ser/Thr protein kinase [Clostridium acetobutylicum ATCC 824]
Sequence
MVKSDIIIVKNFHGVFCLNLVNEIFENKYKIIDILGKGGMSTVYLAKDIKLQKFWAIKEV
SNNINDTSKLKVDLLAETNILKKLDHPALPRIVDIIKRDESLYIVMDFIDGVSLDKFIHK
NGAINEKVVLDWAKQICDVLSYLHSQKPNPIIYRDMKPGNLMLTQNGKIKLIDFGIAREY
KKEVSKDTTYIGTRGYAAPEQYGDCQSDARTDIYSFGVTLYHMLTGKGPNDPPFELKPVR
ELNSSLSEGIEHIIEKSTRQDPSLRYQNVDEMLYDIKNIHKLNSKYKKQLVKKYIKVAAS
ACLFIFSVFLIISGVLGIKSDSANEYNNIIENGSKQNGDKAVEYFKQAVDKNSSNPKAYI
KIIDTYLENGEYDQSIDFIETNLNNKQSELLKDNELLFKIGMAYFDDESYAKAYQYFNKI
KGADISISEPLKYYKPVANALSKVDLQNKDKIVSSITQLEKYIDSRSDVDYKVESYITLA
ELYRDNPQIFPQNTDKEIGVLEKASSVSANKNNAILYGQLGQAYFDKASESKIEQDKYNF
YLNKALDSYKNSIQMGSKISNTYCKLGLIYKYLGNTAESKNTFQKETQLFSDDYKGYMEM
ALLEYDSQQSAAPETRNYSEFVKYYNSTVSKKYNENDVDFMTLKQEYNDLKNQGVIK
Download sequence
Identical sequences Q97LZ6
CaR197 NP_347044.1.94244 WP_010963726.1.17575 WP_010963726.1.17905 WP_010963726.1.48544 WP_010963726.1.57811 WP_010963726.1.71350 WP_010963726.1.92914 gi|337735617|ref|YP_004635064.1| gi|15893695|ref|NP_347044.1| 272562.CA_C0404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]