SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|476416664|ref|YP_007546582.1| from Glaciecola psychrophila 170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476416664|ref|YP_007546582.1|
Domain Number 1 Region: 32-105
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000000942
Family Coronavirus S2 glycoprotein 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|476416664|ref|YP_007546582.1|
Sequence length 215
Comment hypothetical protein C427_5135 [Glaciecola psychrophila 170]
Sequence
MLIMKKLIFVSLIIFLAGCQSAYYAAWEKVGVEKRDILVDRVEDAKESQEDAQKQFSSAL
DEFSQIVSYNGGELQDVYNQLKNQFEASEQSAASVTSRIDKVESVAEALFDEWEEELEKY
TNNNLKRESQNRLRDTQRRYKSLVSSMKKAESKMEPVLSALRDNVLYLKHNLNASAIGAL
QGEFNGIKKEINQLVLEMNKAISESNSFISSMKSK
Download sequence
Identical sequences K7AW83
gi|476416664|ref|YP_007546582.1| WP_007641509.1.30881 WP_007641509.1.41521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]