SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16126419|ref|NP_420983.1| from Caulobacter crescentus CB15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16126419|ref|NP_420983.1|
Domain Number 1 Region: 71-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-20
Family Pentraxin (pentaxin) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16126419|ref|NP_420983.1|
Sequence length 1303
Comment hypothetical protein CC_2180 [Caulobacter crescentus CB15]
Sequence
MCFAAWPIRPRRVCKLALTALNRTKGMTPVTEHRVRDGRHREETVVMRSMFLGSACALAL
AGAANAAPAGDPALLFRLSGDKGLVADIAAGDPIPNFADKVTLIEGRTGQGFRAADDGVV
SWNAPGNIQAQRGTLAFFWKSGYPVGVAPFVIFRVGYADHSSWDMAFLRIDWNGQGFDAF
VTDNGLSRTRVSFKVDKAPAPDAWTHLAFTWDETSGVQLFVDGKLAAKKETKAVYDAGLD
QFGVAGRVIAPHQVQSRYNFTRGGDLDELRVYDRPLAADAIAALARNETPAIAAPVATLD
DPAVRAAWKQRYGWTKAAPPLLADEKTTIRKVEIADAKDIKQWMWRANDGISETTWPGVY
NRSRLPGRDDYFPLPDWNVYVDGGKALTLALPDEPINRIEIQGPAFGDLSWAAKAGEKGA
GVASRAKDQQRSVASLDQPLKGGVLTFTNVAQETPIQELWAYNVFAGAEPKDAFKMSYTV
RAEVAPDYLNLADLNAYIAGRHPMGERATVVALPEGAPNRPRPAGDLAAKGLPIVHVLIP
SGFGDAPAAKPLARNWAYGWENARDGLDGVALDIPALPGAAGAVIPLNIQVKDPIWPGRN
MIDVSVSVKAGEARTVWLDLRDRILTADSLYLTLAADSAEFGPKALDGAKIRLVLKDRDQ
AKVEHIQDRLNQVKDNWAFLVEEHTTSKRQGLYRRLYADISDLLRVDPDNKIGREYWGDI
TYGSQGWPAFEQPKPRDDTPLWAFRQLEDLKLVSKFITWWIDERQADFGDFGGGLSDDSD
LLQQWPGVALMGVQPDKITHSLNRLTDAVYKNGMFTDGLSTIATDELHAYEEGINANAEA
MYVNYGDPLAVERLFTTVKALPRIVDQNPAGHVHFNTNWYSGKISYREGPWEWQKPYSFG
VTHPSILIADYNGDATAKATVLGLADGYLAHAKPDGSLPNEINWRSDAERGGTVLQGSGA
DGPFQLFWSAWRLSGDAKYLAPIQWRIGKNGLKSLAAVNENALTALNLGAPNKDALVKAA
AKGGAFERYAAWTLTGDKTHLEDLYADEIQWNAQHMYMHTEGHWWSDRVELPSDFLQRTR
LGGIANKRGQMNPGHTVSWRFDGADGTDVALLVKDATRSGFKIIAHNTTDKPVTTTMTGW
NVTPGQWRLTQGLDANGDDAIDGAGEARTVAFERSLGTRIVLPPRQTTILDMSLTKAGDD
PAQRADLGVGRGDVTVKGSTVTARVHSLGAHDTATARLDLVDQAGKVLNTAAIPSLKAPR
DLLPKTASVKLKIPAGAKASGLRVRIVSSQPQNTALNDEVVLP
Download sequence
Identical sequences A0A0H3CBM1 Q9A6B4
NP_420983.1.61804 YP_002517635.1.80956 gi|16126419|ref|NP_420983.1| 190650.CC_2180 565050.CCNA_02262 gi|221235199|ref|YP_002517635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]