SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38232653|ref|NP_938420.1| from Corynebacterium diphtheriae NCTC 13129

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38232653|ref|NP_938420.1|
Domain Number 1 Region: 101-238
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.37e-17
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.73e-16
Family GntR-like transcriptional regulators 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38232653|ref|NP_938420.1|
Sequence length 242
Comment regulatory protein [Corynebacterium diphtheriae NCTC 13129]
Sequence
MHMSQSTQRAYQEVLDWLEKELRKGSIAIGDKLPGERALAEQFELSRASVREAIRILTSM
GLVRTGTGSGPHSGAIVISEPSAGLSWAIRMHLSARSLPLKDLVNTCILIESNAAADAAT
PKISPDSPERSHVLNEAHRLLDSMDDPTLPFHDYHIKDVNFHILITSLAGNLVTETIMES
LRYSAIAFVIERLAMRTDWAEVSEKLQREHRNILRAIEERNPDKARTLVHDHIADFYELT
SH
Download sequence
Identical sequences Q6NKK7
gi|38232653|ref|NP_938420.1| APC82408 257309.DIP0011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]