SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38234002|ref|NP_939769.1| from Corynebacterium diphtheriae NCTC 13129

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38234002|ref|NP_939769.1|
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Cgl1923-like 9.29e-82
Family Cgl1923-like 0.0000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38234002|ref|NP_939769.1|
Sequence length 313
Comment hypothetical protein DIP1417 [Corynebacterium diphtheriae NCTC 13129]
Sequence
MNEREAKMYELEFPAPDVASDGVDGPTLIIAMQGYADAGLAVEASADHLLSALEHRPVAV
FNNDELIDYRSRRPAVTIDHNIVVDANELKLSMDVLRDSNGTPFLLLSGPEPDLRWDAFS
QAVADLVRRFGVRRTICIYAAPMTVPHTRPLIVSAHGNSLDLIKHHFSIDSKVTIPGSAS
LHIERLLNKNNIDVAGYTAHVPHYLSASAYPLATLKLLEAITTSTNLDFPLKTLEADAQK
TALQVEEQVAGSQEIESVVKILEQQYDEELEKYRERNPKALEIAEDDLPDADELGEEFER
FLANIDEENGSDD
Download sequence
Identical sequences A0A246CD85 Q6NGT6
WP_010935055.1.12056 WP_010935055.1.15382 WP_010935055.1.16169 WP_010935055.1.21235 WP_010935055.1.22617 WP_010935055.1.2359 WP_010935055.1.24021 WP_010935055.1.24410 WP_010935055.1.24452 WP_010935055.1.24530 WP_010935055.1.34071 WP_010935055.1.42841 WP_010935055.1.43592 WP_010935055.1.4375 WP_010935055.1.44089 WP_010935055.1.4494 WP_010935055.1.52928 WP_010935055.1.58917 WP_010935055.1.69403 WP_010935055.1.70634 WP_010935055.1.71515 WP_010935055.1.73245 WP_010935055.1.73495 WP_010935055.1.73977 WP_010935055.1.77064 WP_010935055.1.80770 WP_010935055.1.816 WP_010935055.1.82314 WP_010935055.1.82318 WP_010935055.1.86272 WP_010935055.1.91366 WP_010935055.1.93248 WP_010935055.1.95894 WP_010935055.1.96122 WP_010935055.1.97188 WP_010935055.1.98240 WP_010935055.1.98565 gi|38234002|ref|NP_939769.1| APC82728 257309.DIP1417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]