SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C09F9.3a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C09F9.3a
Domain Number 1 Region: 165-477
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.08e-109
Family Glutaminase 0.0000107
Further Details:      
 
Domain Number 2 Region: 504-589
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.43e-16
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C09F9.3a   Protein: CE42058   Gene: WBGene00007480
Sequence length 791
Comment CE42058 WBGene00007480 locus:glna-1 Ank repeat status:Partially_confirmed UniProt:B0M0N9 protein_id:CAP72487.1
Sequence
MSTSVPEKGGIFDALRVDSNDPNDSLREELCVTPKIDEKNLEYIGEVLERKKSVVPFLTQ
TINQLALVRNEKMERAADLICTLFRLPHGSTDCSFFRLIKVLRSFGIWENDPRLKQMFDR
MKKHDEENEDSRQWAMSQEKFKEIIFPCTILISRTLRNQLIIPSWLEFTQLIETIFETCR
ESKEGEVASYIPQLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASE
IGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFML
KQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKGLREELDLY
FQLCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAF
QVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLL
HPDDSRKIDPRRKIGPRENETIVQVMYAAKNGDLDSLRRMFMQGADLKTADYDNRTALHV
AAAEGRIKVCKFLINIVGIPHDVRDRWGRYPLDDARQFKNKEVALYLFRLQYPTKRMPEN
WFEVGGDLLVSELEPDNSSVDDGEAESSGEDELGNGITGMLTDDLEKREWALHANGNMGE
INYQLVRRKSSKAPPTPDYKPPQFGYGALPVSKYQQQLQLQQQQQQNEKKASQDKHRNIN
GHGHMNGNGTHTNGNHQHHQPHQLPQNIPHHMLLNGAAGGLNTRRLSSPNEQDEDNVRSS
SSQELLKSLDV
Download sequence
Identical sequences B0M0N9
C09F9.3a NP_497054.2.50509 C09F9.3a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]