SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C33G8.6 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C33G8.6
Domain Number 1 Region: 106-350
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.49e-25
Family Nuclear receptor ligand-binding domain 0.0053
Further Details:      
 
Domain Number 2 Region: 8-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-24
Family Nuclear receptor 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C33G8.6   Protein: CE17496   Gene: WBGene00003632
Sequence length 356
Comment CE17496 WBGene00003632 locus:nhr-42 zinc finger protein status:Partially_confirmed UniProt:O76828 protein_id:AAC25857.1
Sequence
MTRQTTSQTCLICGDSADSLHFGALSCRACAAFFRRKVAGRRNIFRRCDRQCKVDTGMRK
LCASCRYDKCLKVGMRESAVLSRLAKKNQNYKKSIVGSPDAYEPSTSTSDSVLENLQSAY
HKLEETRKRVFNISETHVSQCCNYKRMNDVFFEDIKLVMEHLLETFKKSDISQEQEKLLC
VHFMVPFILFEGGYKSTNSDLFYLPSGDFIDENRIEEYYSNPDDQNDNSAKSAAEVFRPY
WKLNKQTLKTHLDDVQLDLPEFLFITALIYFDDGLLDQNEECIEVCKQMKAKIIEELTDY
EKNVRINEDHSYRVGQIIMVLHGIQRTMNMIHETKEISLVYNVYDMHSSIFGNMAE
Download sequence
Identical sequences O76828
6239.C33G8.6 C33G8.6 C33G8.6 NP_504771.1.50509 C33G8.6 C33G8.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]