SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M03E7.1 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M03E7.1
Domain Number 1 Region: 34-130
Classification Level Classification E-value
Superfamily PapD-like 2.62e-21
Family MSP-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: M03E7.1   Protein: CE07394   Gene: WBGene00019753
Sequence length 146
Comment CE07394 WBGene00019753 status:Partially_confirmed UniProt:Q21500 protein_id:AAB00727.1
Sequence
MSSSTTDDDSCSYFFFRQACLIPTPSVPTHPSVSIKIYPPFAEFIDFGGASRHILTNNGT
CRIVFKVKCSNNLVFKVSPVYAFLDPGATAELQVLRREGPPKHDKLIISLKEAKKGDKDP
RVTFNDSTHTTHKHILPLLTRIVEEQ
Download sequence
Identical sequences Q21500
M03E7.1 M03E7.1 M03E7.1 NP_504485.1.50509 6239.M03E7.1 M03E7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]