SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0310.1a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0310.1a
Domain Number 1 Region: 130-210
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000144
Family Voltage-gated potassium channels 0.01
Further Details:      
 
Domain Number 2 Region: 86-135
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000785
Family Voltage-gated potassium channels 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: B0310.1a   Protein: CE41749   Gene: WBGene00015137
Sequence length 264
Comment CE41749 WBGene00015137 status:Partially_confirmed UniProt:Q10937 protein_id:ABX00824.1
Sequence
MRNSACLAKIHFNKIQDDNEAGIFRLDAKRSDLLNVLWAETITNGEDDWSELADQKLELY
EKALLQHYGIDLDKSDKSFASGLQKSFAISTTIGPLDVDDFTTLGKLIAVLYALIGTPLF
LTVIGQLGKMVTSVWQGTTLWIVTIVYIFISAVIYDIVEGGSDDVPFIEAIFSIFLQFTT
VGEVDNEFHGVLPYCIVVLGLALITALYQEMQHNIERFIHPFEYSFNRLCGNVERWAGEK
SEDKKSIVTSRIEEENEDEISDYE
Download sequence
Identical sequences B0310.1a NP_001123087.1.50509 B0310.1a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]