SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0350.2d from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0350.2d
Domain Number 1 Region: 477-561
Classification Level Classification E-value
Superfamily DEATH domain 1.45e-16
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: B0350.2d   Protein: CE37695   Gene: WBGene00006780
Sequence length 795
Comment CE37695 WBGene00006780 locus:unc-44 AO49 ankyrin status:Confirmed UniProt:Q5TYL5 protein_id:AAV34806.1
Sequence
MRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKF
LGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQL
DDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKT
IKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQY
SGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTP
RDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLI
AKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAAT
EGRIGFMAEPKIRSDALPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEK
DLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKNTLKIWIHLKKEDAN
QDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIRHFEEVPAATLVKREV
RTEDLVTREPVQPTHHVEQATTVVQEPSYSAPVHHSPVPEEPEMEEEAPVAEMRTVVRTE
RHVHDSEDGPVVEERTITTTYEDDVAVNENIVDRTVPLNEDEQQKWEELNRLADESSPSP
AQRSTIVAESTSEQVPEDVEQSVESESHREDDGTIVTTTVTTSHISESPSGSPTRRSVEP
EEHRHSQHEDHEGST
Download sequence
Identical sequences Q5TYL5
B0350.2d.1 B0350.2d.2 B0350.2d NP_001021267.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]