SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0513.2a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0513.2a
Domain Number - Region: 68-174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: B0513.2a   Protein: CE23510   Gene: WBGene00007195
Sequence length 210
Comment CE23510 WBGene00007195 status:Confirmed UniProt:Q9U3S3 protein_id:CAB54184.1
Sequence
MKEDTLLRKLVADGEGVGDDRKVQQIATFFRESRKEDAKTSVPEAVKVTKALEFLELSML
KQKRISHMNKIHATECDQFAEEIDQSIEEMYKKMEVAKNELADAKIVKRNRQEYRKLVNV
LEEVPSRAETTRKLGEVKDDLERQHERQKVLEAKLMDRRNHLQAFMIILSNFQRFCAEDD
DDDAEVMSNPGEDDDAASVTEKQQEDDVRK
Download sequence
Identical sequences Q9U3S3
B0513.2a.1 B0513.2a.2 B0513.2b.2 B0513.2a 6239.B0513.2.1 NP_001255765.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]