SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C01G6.8b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C01G6.8b
Domain Number 1 Region: 553-836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-75
Family Protein kinases, catalytic subunit 0.00000134
Further Details:      
 
Domain Number 2 Region: 324-412
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-23
Family Kringle modules 0.0017
Further Details:      
 
Domain Number 3 Region: 8-107
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-19
Family I set domains 0.0088
Further Details:      
 
Weak hits

Sequence:  C01G6.8b
Domain Number - Region: 178-268
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0327
Family Frizzled cysteine-rich domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C01G6.8b   Protein: CE24774   Gene: WBGene00000289
Sequence length 902
Comment CE24774 WBGene00000289 locus:cam-1 protein tyrosine kinase receptor status:Partially_confirmed UniProt:Q17576 protein_id:CAB61003.1
Sequence
MEGTSTGQRPYIRLTSQLRNATKSSGDEVRFKCEALGTPPLKFIWLKNNGPVEKTKRVKI
RDKENSSRLVITQLDVLDSGYYQCIVSNPAASVNTTSVLRVNNVPDAVKLSQKKGSHHST
KHIAFDEYEDYEMMDRGRLPDEEDADLYRVPDSAAGSNYAPVAVSERWLDGIKYRVGDCV
QYRGEACRQYLSNKFVMMTNESREEMYDIDRNLRAAMLFINGAPTISQKCRQLSQAVACH
HMYKVCESDSNNQIVSICKHDCDVIQNDECPSELALAAQHELVGDTPKALFPLCSRLSST
SNCIPVMSTALQSSPVAEVNRGHLTHWCYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDF
NVHRFPELMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQCPSDMYPHLNDKKVEGST
KGGVSESVTALWDSLDPTMQVALVGGGVFFSLLLLLLFCCACCCRAKKKSQKTRHQNAHC
SSAPSVINSAANSAYYRKLNGTSTPIMGRVPPHVEMTSLLPSAQHLGPPPYPMDQHLQQA
RRFPSQEPIDDNSYKVFEITPSQLSVREKIGEGQFGVVHSGIYTSGLFAPEPMAVAVKKC
RHDATNAERAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHGDLHELLKVRV
PPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFG
LMRTSYGSDYYKMLHRSWMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQPYEG
ASNQQVIELVANRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSWSLASPA
HSILQQHNNRAGSHSGSSGAGRPPTHQRGYPSQKLHRRVEGASPLMKRHDANYAYSEDGD
SD
Download sequence
Identical sequences C01G6.8 NP_001021908.1.50509 C01G6.8b C01G6.8b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]