SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C01H6.5e from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C01H6.5e
Domain Number 1 Region: 111-359
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-33
Family Nuclear receptor ligand-binding domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C01H6.5e   Protein: CE39085   Gene: WBGene00003622
Sequence length 361
Comment CE39085 WBGene00003622 locus:nhr-23 status:Confirmed UniProt:P41828 protein_id:CAJ30219.1
Sequence
MSRDAVKFGRMSKKQREKVEDEVRMHKELAANGLGYQAIYGDYSPPPSHPSYCFDQSMYG
HYPSGTSTPVNGYSIAVAATPTTPMPQNMYGATPSSTNGTQYVAHQATGGSFPSPQVPEE
DVATRVIRAFNQQHSSYTTQHGVCNVDPDCIPHLSRAGGWELFARELNPLIQAIIEFAKS
IDGFMNLPQETQIQLLKGSVFELSLVFAAMYYNVDAQAVCGERYSVPFACLIAEDDAEMQ
LIVEVNNTLQEIVHLQPHQSELALLAAGLILEQVSSSHGIGILDTATIATAETLKNALYQ
SVMPRIGCMEDTIHRIQDVETRIRQTARLHQEALQNFRMSDPTSSEKLPALYKELFTADR
P
Download sequence
Identical sequences NP_001032970.1.50509 C01H6.5e C01H6.5e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]