SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C26B2.3a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C26B2.3a
Domain Number 1 Region: 230-466
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-42
Family Nuclear receptor ligand-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 81-166
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C26B2.3a   Protein: CE17474   Gene: WBGene00003625
Sequence length 583
Comment CE17474 WBGene00003625 locus:nhr-31 zinc finger protein status:Confirmed UniProt:Q18192 protein_id:AAC24263.1
Sequence
MEQLDVEDWEYWGDEYLEEEPTYAIRPGTRVVKVERVPMMRGDLRTSGATSSSGPATSYI
IRPSDKQPTVSSGGSQNGDSVCAVCGDGIAKLHYGVLACYGCKGFFRRTLTGKYRYACRF
SNNCIVDKFQRNSCRYCRFQRCIQAGMDPKAVRPDRDQTGKQKVPRIKKKQIDEELLNHM
MRLQGDDWSRKLPVETRILLMQLMSIEDKVVKGDNNMSAQNTAKDPKSISLREMFESKPA
LDGRRMEIGYEPFRMARTEELGVIAHRRAIAAVDWVDSLTEIADAVDTEDKVALVKSCYS
PLTIFNFSARTAQNTKNPDILCLCSHSFVPRRLPPEFNETNHLSNFLIDRTLNELVAPLR
KLNLKEEEIVPLKAIIILNPNAKGLSEHARHAISELRDKVQDMLFQIVKELHPIYSASSR
FGNLLLLLPTITTLSGLMSENMHFCQALGGRASGDNLLAEMFGDRTFDDQLISSSISPPL
FENPAEICLESISPPMSDRRFVRRVDVATQTNDDLLSSGPYLPHSNSCSSMLNAGYSPPM
LSTSPFPLLDDNDSAFQNDISLTELNGCEEFFSQLMDQPIIDS
Download sequence
Identical sequences Q18192
C26B2.3a C26B2.3a C26B2.3 C26B2.3a.1 C26B2.3a.2 6239.C26B2.3a.2 NP_741456.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]