SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C27C7.4 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C27C7.4
Domain Number 1 Region: 14-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-18
Family Nuclear receptor 0.0014
Further Details:      
 
Domain Number 2 Region: 128-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000115
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C27C7.4   Protein: CE19336   Gene: WBGene00003663
Sequence length 326
Comment CE19336 WBGene00003663 locus:nhr-73 Zinc finger, C4 type (two domains) status:Partially_confirmed UniProt:Q9XXL7 protein_id:CAB03927.2
Sequence
MSTTVGRPSNEIASCQVCHSTERTRLYFGITSCAACAAFFRRSDGIRYMCTATNSCTISH
DMKFFCRACRYTSCIRAGMVMSRNALATARKAPNNIIPREPTPRSVPSLEEVDGFSKILN
ISNGDLLKYYVKEVESIMAQQRYGEQKNALQVKSVNDLMIVTAYQEGTSLESCFNCPGVD
ILYNEDVEVVHKYFKFSNTWIDSLLAPTSPLDPSCNERISEFIHLLKSTLGSTLAQLNLN
IIEYAAFKSFCIWKLVYHKTSISMKIVAQEHYEGVTSALRKYYRKNIKMSELEMATRIGD
ITLQIITVSNLYNDMARMYHQTGLQL
Download sequence
Identical sequences G5EGP2
C27C7.4 ZK1025.10 C27C7.4 ZK1025.10 ZK1025.10 NP_492921.2.50509 NP_492932.1.50509 6239.C27C7.4 6239.ZK1025.10 C27C7.4 ZK1025.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]