SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C45E1.1b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C45E1.1b
Domain Number 1 Region: 95-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-49
Family Nuclear receptor ligand-binding domain 0.00000893
Further Details:      
 
Domain Number 2 Region: 24-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-16
Family Nuclear receptor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C45E1.1b   Protein: CE39697   Gene: WBGene00003654
Sequence length 344
Comment CE39697 WBGene00003654 locus:nhr-64 status:Confirmed UniProt:D4YW56 protein_id:ADE60676.1
Sequence
MTLEEKEEVSTSTSQSPQSSSFENVFCAICGDRATGKHYGAMSCDGCKAKRNSCRKCRFD
VCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVPDDPLLDTLIRAEASTRGLRTTVITK
TAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQRVDNITQVALLRHFSAQHLVMCAAF
RSIHLSDAVWLTNETCLHKDSPKIPDMNRVAERIIDQVTNPMRSLHMNEIEYIALKAIAF
FDPLAKGITSESYSDVEEMRQRILESFERHVRYVSPYKDMPLRFANLLLLLPPMLAISRD
LVEDVQLAKLFGLASIDNLMLELMLPNEGKNTTDKTSPPIMCHQ
Download sequence
Identical sequences C45E1.1b C45E1.1b NP_001021043.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]