SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F15D3.4 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F15D3.4
Domain Number 1 Region: 353-714,780-817
Classification Level Classification E-value
Superfamily Serpins 2.75e-34
Family Serpins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F15D3.4   Protein: CE19795   Gene: WBGene00008854
Sequence length 823
Comment CE19795 WBGene00008854 status:Partially_confirmed UniProt:Q9XVQ1 protein_id:CAB02959.1
Sequence
MEQKNEEIEAIDDRMIAGVEVNFQKMRRSKHKTEERLTSGQVDAFAQKLFEAYPDGSLEG
FLDIDDVQKKKLDEQRQEFTGDYPIVQPVLDGSRELMVVLRYNPLYHAVEIYDPVQIYDS
EGIPMVVKPIREQIVNLFAHLFLDKIRLIFDIEYEQQADKCSDRLRAVGAMMAIALGYNP
AAMDYNLKGISKLVKKILNSESPDFKKFEKADIGTLNAKYSGQNRVTMFIGNNGETLLAT
RNVYGLEKHALKTGLGKMDKNGHVVERESFLEEEFHDETIYKQFHAPDLGMGKPDNVNAI
KLFHVDYRDYDLQNANGLERPIYLEPYKPVQSDCFAVPNLTSTLDRVSSNGELLKYVNEV
MQSITPYTPYHLHAQSVEYLRYTPRHMNMCINPLQAIRAWALLANMADGKTNTDLLNFVG
KYTYPGQLENNKMMNDDILNLHFEAEKLFEGCVRVFTELPKHLWHNEDIRIIQNSYYGGK
SLRGAMQHHCFATDPDGLYSCHRINEEVALSTHGAVNFVVPENHAPNWRASIALVSAMDC
TFYWKTYAKPKLMDNFNFVNEQYGASKCVGYFAHADFKFFEDIYCLESRIPGVRLYITFE
SPDKMDSKKEFMSKLHEKIQTCGDWHTTFDSPVFLPLCTTSTPLSLYAHAKASGLSRIFS
SEKSELLEMKSIPARGGARQFSTLYDHYHKTVFEVHGSDPKVENFMRKRPRRMFDQFSPA
RAHQCVDDSMAELHGKYQMKNPTKEFNNKMNINPLLTYRENHLNHDEPSFEWLHENHEFD
LKDPKALMFNKPFYYVMTRALVGKNQLIVCAGYFNNTTWVKQQ
Download sequence
Identical sequences Q9XVQ1
F15D3.4 NP_492950.1.50509 F15D3.4 F15D3.4 6239.F15D3.4 F15D3.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]