SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F16H9.2a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F16H9.2a
Domain Number 1 Region: 92-330
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.17e-45
Family Nuclear receptor ligand-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-17
Family Nuclear receptor 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F16H9.2a   Protein: CE05645   Gene: WBGene00008901
Sequence length 334
Comment CE05645 WBGene00008901 locus:nhr-27 Ligand-binding domain of nuclear hormone receptors, Zinc finger, C4 type (two domains) status:Partially_confirmed UniProt:Q19500 protein_id:CAA90294.1
Sequence
MSTYVSNCVVCGRLTSLFNYGAHSCSACGSFLRRTLASSKFLDDCKYSGNCFENFKRAIH
FECKFCRLHKCVQKGMLDLSRYTHLERLICELSEFDSKRETLFLTMTVSNGFKAEELMWQ
SSVSLVKKPPHLVFNSHDWGFMNQVTIIDFLKKLEFSKFLSSQDLRSFLKCTHFTQVILK
SAVISYNANQNYMSFPNKIDIFPETVTEGTSISVNLQNRIRCRLVNRLIELKVTHEEMLL
LCAIAFSNPAIPELSENGRTLLNSYQNVYRSALFQYCSTAYQRNGPSRFNDLLFLLHVVT
KTHDDIKKYFTLFQFFQPTEQPSQVHQDVIEFIN
Download sequence
Identical sequences Q19500
F16H9.2a 6239.F16H9.2 NP_001257198.1.50509 F16H9.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]