SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F25E5.6b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F25E5.6b
Domain Number 1 Region: 162-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-44
Family Nuclear receptor ligand-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-23
Family Nuclear receptor 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F25E5.6b   Protein: CE35288   Gene: WBGene00017787
Sequence length 406
Comment CE35288 WBGene00017787 locus:nhr-141 status:Partially_confirmed UniProt:Q7KPC9 protein_id:AAQ62458.1
Sequence
MSKESTFQRHPRPTECSVCGKKATGYHYDVPSCNGCKTFFRRICISEKTMQCQGVGDCFD
LTKRIAPVKCRACRFEKCVLKGMNPNAMQIDEKEESAKNYKHLKKLKNQYCQKDSEHSME
KKQTINSIDAIETKMQKLVDALSYLEIKLRKFRLSAYNPHWSTIPCLEEFLLLENKICLA
DKSGPMPGWPLKTQPAPPKIPEFRNNPSGRPYFPDKKTWLLYDLMVSIEYAKTFMFFHQL
GTRDRLILMRYVSLALMNLHISYFTVAKKFDTIIHPDGSLAPMNKGMVYAETVMSMAPLI
RCNIQEIEYILLKAICLCNPAVPELSTHAQKILAKEREQYADALFDHCIRSRTNGPAQFA
ELISMVDILERQQRMQKDLHLLHIAPYASKFPQNDRMLLVDDIMNY
Download sequence
Identical sequences F25E5.6b.1 F25E5.6b.2 6239.F25E5.6b F25E5.6b F25E5.6a.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]