SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F41B5.9 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F41B5.9
Domain Number 1 Region: 176-401
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.14e-34
Family Nuclear receptor ligand-binding domain 0.0067
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-29
Family Nuclear receptor 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F41B5.9   Protein: CE42115   Gene: WBGene00018265
Sequence length 402
Comment CE42115 WBGene00018265 locus:nhr-182 nuclear hormone receptor status:Partially_confirmed UniProt:O16676 protein_id:AAG24105.2
Sequence
MLLSECEICGQPSHGNHFGVISCRACAAFFRRATLNSKKKLNLNCFHDNNSEINKNGFFS
CKKCRLKKCLEKGMDASKFQLDRDKITNAIVPVNTPEIITPSINTFLGRPSFLTLCNPMD
EDSPGPIRNIIDCNYLLDRATEILKNGSWQPYNPEMTSLEKISMGFENMRILKSSKLHYL
THMGKDQTMLIWEQEMLSTAEWLTNFQEFNSLPTNVQLEVIKSIWQTYGRFEKLARTAEF
RRKKLFKNNNVFMVGDEACLDTENVEVDVSWFSDYTYEQVSYFMDCFHNEIFLQIVKEFE
ALNPTTTELNFMLLQVCLHHAGKKLQGDVATMTDYLEEVISNQLHHYYQEVRKLPNYSAR
LARMMKVNNLMRTDLRQKSEKAKLAMAFDVFKLQFSHPEMMC
Download sequence
Identical sequences O16676
6239.F41B5.9 F41B5.9 F41B5.9 F41B5.9 NP_503620.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]