SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F41D3.3 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F41D3.3
Domain Number 1 Region: 8-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-19
Family Nuclear receptor 0.0017
Further Details:      
 
Domain Number 2 Region: 172-345
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.7e-18
Family Nuclear receptor ligand-binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F41D3.3   Protein: CE16022   Gene: WBGene00009608
Sequence length 348
Comment CE16022 WBGene00009608 locus:nhr-265 Zinc finger, C4 type (two domains) status:Partially_confirmed UniProt:O45507 protein_id:CAB04374.1
Sequence
MQVTAEFTHCPVCSLPCSMRYSHFGGICCPACASFFRRTVSLNIRYLCKKQNNCSGISKK
YHIVCRACRYEKCIKKAGMKRSLVQHKQSDKNVPKYILLNEDRDVEFVRGFTTSSPVLKA
SPVASEDFSKILNIGSRDLLSYYVKQVESVEKQRFKNALQIQSVNELVTLQRTSTDSCLH
CPGVDILDRESAQALRKHFQFADVWLDSAWEFSKSPELLFALGRSNLNNLNSLNNMNNTN
QELSEFISLVKSTLVSPLSRLRLDITEFAAFKAIATWKLIYHETSTAMKIIAQEQYEGVT
FALRRIYKTSRSIDDIEIAVRIGDLTLLVSAISEIYKEMVRLYRQMGV
Download sequence
Identical sequences O45507
F41D3.3 F41D3.3 6239.F41D3.3 NP_493092.1.50509 F41D3.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]