SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F43C9.4b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F43C9.4b
Domain Number 1 Region: 36-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-16
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 175-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000011
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F43C9.4b   Protein: CE34562   Gene: WBGene00003245
Sequence length 356
Comment CE34562 WBGene00003245 locus:mig-13 status:Confirmed UniProt:Q7YZV9 protein_id:AAP82652.1
Sequence
MICIIFLSDSITSTCFYSGFFDGLDSRNECKARLDRRLTGFSGLLYSHSKYGQEPYNTSR
NCVLMLVAPIGYSIRVRALQFDVASTENARTCEKDTLHVFDHETTLDPESYAPARIDDIT
SPGPIIGQFCGHFENRILNTSSHNALTLWWHSNPNGSNSKGFKLHWGSFRVSKTGNCVTG
EFSCGNGECIPIESACDRFADCSNGEDLIHSRQMAANCQNIELDPLTTVSGVFVLLFSAT
IILSLCGFIMFVCCLCKCLKSTIPIKGASSHTTTTTATDYKPDPPQFYPPSPPKMPPPSA
ASSYTPRLHHHFEGPLVPSETSAFHSSNRMQNHYSVNSDINGDYTYVRNDVHRNLL
Download sequence
Identical sequences F43C9.4b NP_001024661.1.50509 F43C9.4b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]