SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F44A6.2 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F44A6.2
Domain Number 1 Region: 251-491
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-31
Family Nuclear receptor ligand-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 149-224
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F44A6.2   Protein: CE03323   Gene: WBGene00004786
Sequence length 534
Comment CE03323 WBGene00004786 locus:sex-1 nuclear hormone receptor status:Confirmed UniProt:P41830 protein_id:CAA90722.1
Sequence
MSFETKPNYLLLTNPDTPLSVCTSPYYSPSGKTASIPSSEASKPEGTNGQWSHLPTGATY
VTDEFSSEFQIQNGSTAAQSGNANNYADPLSHRRYFNNVNGYNHHQFYDTASQASVSSPA
TSVTSSLSPPDSLSNGHTTQRHHIGKAISFCKVCGDKASGYHYGVTSCEGCKGFFRRSIQ
RKIDYRCLKQQVCEIKRESRNRCQYCRFKKCLDSGMSKDSVRQMKFRNAMRDDKSPDSVF
VPEISTLERQEEVDAVYEAVLRAHTTFSFYTDIKIRSIVARPFNVRINEDSKMNRLNAWQ
IYAHEIDVDIKEVVNFVKEIPKFNFINGNDKAVLLRKNAFPLYLLRIVRGMSNRGLMLRD
GRLIDFKSLQLLYGSLADEMLAFANHIITIGCTDGDIALFIVLILCQPLTTEQQFSTNFK
SQLQLLEMFDFYKKVLFQKMTCRIDGCDTYKQLMKCIHELNRLNELHKQQLNILRENLSF
LNLPPLVVEMFQLSTLPLPVNHNNQENQYTPAPEHQSPQPQQPTPNQQQTPVHC
Download sequence
Identical sequences P41830
F44A6.2.1 F44A6.2.2 6239.F44A6.2.2 NP_001024662.1.50509 F44A6.2 AAA96982 F44A6.2A F44A6.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]