SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F44C8.2 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F44C8.2
Domain Number 1 Region: 161-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.05e-37
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 10-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-25
Family Nuclear receptor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F44C8.2   Protein: CE17823   Gene: WBGene00003724
Sequence length 407
Comment CE17823 WBGene00003724 locus:nhr-134 nuclear hormone receptor status:Confirmed UniProt:O16361 protein_id:AAK84532.1
Sequence
MPAPLFLSGPCEICGQKTSGRHFGVMSCRSCAAFFRRAATCSRIFGRCPNGNCKLLENGK
FKCKKCRMKRCLEVGMDETKFQCNRDLISSSNKFQKRVSLIEPPPQSLSTFLGRPTLLLC
CEPTRASHIKTLINVTYMVDVARDILKRDVSTKIPYQFHNSLERLALSLEEIRSREPDEK
IKMLRKIGQEESLLIWEQAFLRAVEWFSNFSEFNALDELSKMTILKSAWISWTRLEKLAE
TADHQRKKIFGDSVMMCGNDACLDLANYEVDLTWCTNYTTEQLLFYLSPEIEQNHFLSLQ
ELVELNPTSTELSYMLLQITLHLAGKKAQGQLLEITEMLLEAQGNHLHEYYVKKLKMPNY
VMRLAKLMKINRRIESDMRDRVEKNHIARIFNILKVEFSEPDMFEST
Download sequence
Identical sequences O16361
NP_503610.1.50509 F44C8.2.1 F44C8.2.2 F44C8.2.1 F44C8.2 6239.F44C8.2.1 F44C8.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]