SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F44C8.5b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F44C8.5b
Domain Number 1 Region: 204-450
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.85e-37
Family Nuclear receptor ligand-binding domain 0.0082
Further Details:      
 
Domain Number 2 Region: 54-138
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-27
Family Nuclear receptor 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F44C8.5b   Protein: CE10386   Gene: WBGene00003718
Sequence length 451
Comment CE10386 WBGene00003718 locus:nhr-128 status:Partially_confirmed UniProt:Q7KQA0 protein_id:AAQ62454.1
Sequence
MGMPPNCCYFFKFSASLANRQKSICQTAKASGSSFKFFLDFQINMPPPLFLSGPCEICGQ
KTSGRHFGVMSCRSCAAFFRRAATWKTERADCKKENCQIFERGKFSCKVCRLKRCLEVGM
DASKFQSNRDLISSSHSFGKPKSLNLPQSLSTFLGRPAFILCCEPDKTSGRKTLIDVSYL
VKEGRDLLRTEPHLSHIPYKFNDSLEKISLKLESLRTTELNNKIRMLKKLGKEETMYTWE
QDFLRVIKWFANLDEFNDLDEDLMLNIVKAAWIPWTILEKLYETSDYQRKNIFSKTVLMC
GNDTCMDMNNYELDLSWLTDYSLDQLTYFFTPPEANKNYLKGLEALIELNPSSIEVNYML
LQLSLQHAGKILLGSAQEATDKLQHVLADNLHKYYVETAKIPNYSIRLSKMMKINREIER
EMRDRAERNRIARIFDILKVEFSDLDLIDAT
Download sequence
Identical sequences F44C8.5b F44C8.5b F44C8.5b 6239.F44C8.5b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]