SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F44G3.7 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F44G3.7
Domain Number 1 Region: 194-552,662-697
Classification Level Classification E-value
Superfamily Serpins 1.76e-35
Family Serpins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F44G3.7   Protein: CE16038   Gene: WBGene00009708
Sequence length 705
Comment CE16038 WBGene00009708 status:Partially_confirmed UniProt:O45520 protein_id:CAB05519.1
Sequence
MPGIRFNGVAARNVRDKKKKSQSTTTQKTGHTQNTTGTADGFRGLDQKEIDQLHKELYAQ
AKKKNKEKYGTTSEGGTTRHGTTGGKTTGGDTTTGLTEGTGLTNIDQQLKKINALLENDE
SEPGTEKHDGPFDIQKHRNWLNLFKVDEYDYMLQYANGTEAPLIKPQYKDEAENVIFGEE
VELKFDLAQTNHSLLKYANEVMSKVVPPKLRHINAATVTSYRYTAPHTNMCFNPLQAIRA
WALLGTLANNKTFTDIMKFVEKCTAAKFVDVETMSSQLFALHYTAEEMFHGCVRAFTELP
LHLEKNYALRDFQNQYYGGKSRRFALQHHSFATDPDGLYSCHRINEEISRSTHDRVRYVV
PENCAPNWRASIAIASAMDCTFEWVVEKKLGFSENFQFFCAKYGYSKCNALHAGAMVAVY
GDVYRLASVDENVKLFIYFEPPEDVDKEKSINPKMFANILATDCFKETLYDVWIPDCTTS
TPLSLYEHAKANGLSRIFSCEKSELLQMRCIPTGGAPQFSTLFDHYHKAVFNIQYSDEKK
KEENVSEPHKRKKKTERTIDVLAPNRLHQCIDDSSASSFGKYQLKTFELSQDVKVKLRNV
DKAEEKKPKDKKQKEAEKQFREDFKRKWGPLMTYHEDHLKCVQPSFEPTQSDTQFEDNKQ
YHGHPEFTLNFGKPFYYIMTRMLNGVPFIVCVGYFNNTTWVKKRK
Download sequence
Identical sequences O45520
F44G3.7 NP_507062.1.50509 F44G3.7 F44G3.7 6239.F44G3.7 F44G3.7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]