SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F47C10.4 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F47C10.4
Domain Number 1 Region: 123-353
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-44
Family Nuclear receptor ligand-binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 26-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-21
Family Nuclear receptor 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F47C10.4   Protein: CE10662   Gene: WBGene00018542
Sequence length 357
Comment CE10662 WBGene00018542 locus:nhr-187 status:Partially_confirmed UniProt:O01564 protein_id:AAB52274.1
Sequence
MGSDYSEASSSSSPEMFALNLTGQKACVVCKRPANCYNFGVMSCDACKMFFRRTMLLNVQ
YVCRRKNQCFDDSFSCLKTPYCRACRLVQCVKVGMKLNLSAMLEVKNQKDDAVATLIESL
LYQDARREKNLMTHFTYENPTLEDIIESRQLTLVVRDPSHEMTSSDWCFFGAYTAVKFLL
GLGFMKKLSTRDKSLLLANYSAKATLLFSAIRTMRAKNDKMIKPDGKDFFVEFLSQWSDF
SLHYTNRIRSLLVNRLIELNITNEEFILITVLFFCNPALDDLSESAVAVLTEQQKAYGSA
LMQYCKLSYQHNGSSRFTELLSLCTVTNKYYEDVQYLYWIFQFHFHVKYKNLVSVII
Download sequence
Identical sequences O01564
NP_504066.1.50509 F47C10.4 F47C10.4 F47C10.4 6239.F47C10.4 F47C10.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]