SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F53C11.6 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F53C11.6
Domain Number 1 Region: 391-581
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-30
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 234-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-21
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 3 Region: 30-62,120-216
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.03e-17
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F53C11.6   Protein: CE41135   Gene: WBGene00006684
Sequence length 614
Comment CE41135 WBGene00006684 locus:twk-32 potassium channel protein like status:Partially_confirmed UniProt:Q93764 protein_id:CAB02119.2
Sequence
MCGGALLSSGLCRFSELTPGQFGLTKQLVFRLALPHITLLVVSILYAVFGGWMLTLIKYS
QQTTHQAIMFDQTRQNFAKRLALIGNKEEFESIVDELVEKTYDFYTMEDGHRWQEAAFNA
NPLTNFTSNLFFAATTLTSIGYGIDAPESLIGRVFCLVYLFFGIPLYLITIADMAKFCTE
LMNRTYTEIIKYKYRVKRRYKRWKSGRIRRESMKVGQVIIAGGEDEVAEFLWTHLEHAQF
VEVPFLLVIGILLLYIGLSSWIISWVENWNMMDGFYFVMMSVLTIGFGDLVPRNEIFAVP
ILFIILAGLVLTTTCIDVVGAYYIDRLHFFGRRLDDDPLSWLKEVQQRRIEAMKKEAMRK
LFETVTALHHIRLTAFKQLTQNYDEHLRGKAPDPPRHLIASHATADSVMLRWSAPIYVDE
GKRYWYTITYKPRTPQRRNNVVAVDFINKDRYLVTGLKSFTLYEFSVYVTTRYGQSVPIK
VQEYTEPCTVPQSVRIDAISDETATISWRAPKMNNGPESYVIQFVQEPAPQFVYWCKYKV
GSSTRFTLTDLHADTRYIICVTAEHNHGLAAMSKSMRFRTKKWWGDEDSTCLRIPGTSHR
LSIASAISTLTALR
Download sequence
Identical sequences Q93764
NP_506416.2.50509 F53C11.6 F53C11.6 6239.F53C11.6 F53C11.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]