SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H12C20.3 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H12C20.3
Domain Number 1 Region: 152-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-40
Family Nuclear receptor ligand-binding domain 0.00074
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-29
Family Nuclear receptor 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: H12C20.3   Protein: CE18808   Gene: WBGene00003658
Sequence length 385
Comment CE18808 WBGene00003658 locus:nhr-68 nuclear hormone receptor status:Partially_confirmed UniProt:Q9XXM8 protein_id:CAA18351.1
Sequence
MENKEVCLVCQDFSSGYHYGIPSCNGCKTFFRRTVMKKQKFVCQFDQNCPVDKSIRCACR
FCRFEKCLKVGMDKTSLQASRDPIGYTKRNKKTLRHPMNELSGDESNSCTPDRQLSPLRS
FENSLNFLAVRERSANELRMSSYLPKRSLKQALCSKPLINDPIFMSKHATVSPRHTFEKL
RFITQDDYHYWHERDWFVLTEYAKTFKVFKNMPYHDKTELVCHAAIVIPVLNQVYNSPDY
GLDTVVFPDGTYYDRTHEPTRPAGLNRKKYQVLDLVLKPFREMEINFNEFAAFKAITFLN
PDADISLESKHAINEERVLITKQLYAYMVQKDGLEKAIYRFGRLILMGTSMSKMACESKE
AVWIADFFENIGFTSFAKELIFGDH
Download sequence
Identical sequences Q9XXM8
H12C20.3a.1 H12C20.3a.2 H12C20.3 H12C20.3 6239.H12C20.3 NP_001256334.1.50509 H12C20.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]