SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H27C11.1b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H27C11.1b
Domain Number 1 Region: 74-314
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-32
Family Nuclear receptor ligand-binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: H27C11.1b   Protein: CE39262   Gene: WBGene00003687
Sequence length 339
Comment CE39262 WBGene00003687 locus:nhr-97 status:Confirmed UniProt:Q9BJK5 protein_id:CAJ43448.1
Sequence
MKIEAVKMDRKLTKRKKEKTDEDDTDDGGSHESFETTTDAKRAKFDNSLLISSLQLIDKT
SSAGNAKLSTLHFVQPSLQNLLDEPELLDGFRSEMSYRATRQADEQLCYDSERRLVTWAI
DWCRQTAEIADVHHTNDKISLLRASCAPLVLLELGCQSSFGPSDTQIPFCNNSFLSAHCI
PPSTSFLRWKTIQSLNKWAQRELKPLCLRAKEIVLLKALIALNPDANGLSSDAESSIRML
RERVHTALFQLLMENSEPITAASRLAQILLLIPQLSLMGVDVIEQVKVRNTFNKRSAFGE
GLLFWQLYGDIFDDANDDSYLEHSASCSPTDSQYTTDSI
Download sequence
Identical sequences H27C11.1b.1 H27C11.1b.2 H27C11.1b.3 NP_001040955.1.50509 H27C11.1b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]