SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K06B4.10 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K06B4.10
Domain Number 1 Region: 129-355
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.13e-24
Family Nuclear receptor ligand-binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 21-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-19
Family Nuclear receptor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: K06B4.10   Protein: CE11800   Gene: WBGene00010604
Sequence length 405
Comment CE11800 WBGene00010604 locus:nhr-199 Zinc finger, C4 type (two domains) (2 domains) status:Partially_confirmed UniProt:O17934 protein_id:CAB05766.1
Sequence
MFTLARVLNNIGSASSNEPIPYCLICSEVADGNHFGVAAACRACAAFFRRTVQHNKIHEC
GRNGQCFFLSCKFLLVGFQISPLSSDARSMCKACRYGKCLEMGMQRSSVQQRREQLGKRL
NISDDRGKPVLNKLRRAYEMLILNRKHVHNRRENQAPRAIGFNELPIVFQNESTSIYQFL
WEAFPEYSMLLPDTKLAFFKNFFLSFCLFESSFNGCSAKQKNVMLIPSGDYIDLAHSESF
FTNDHQTFTERDNIEILAQRLKLIQSSITVPLSAENVDIYEFLALAGIILLESDSESEAD
FQEEAVKIKSNIIKDLLFHYQCINIYDDAAMRLGAVLSILPSIQVCCSRSNNFLIINSKD
VSESQSPFSRIHGNQKYAQFVRSSQESLRHVLANFIKFICKFVSI
Download sequence
Identical sequences O17934
K06B4.10 K06B4.10 K06B4.10 6239.K06B4.10 NP_506905.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]