SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K08A2.5a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K08A2.5a
Domain Number 1 Region: 193-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-34
Family Nuclear receptor ligand-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 35-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-29
Family Nuclear receptor 0.00011
Further Details:      
 
Weak hits

Sequence:  K08A2.5a
Domain Number - Region: 138-180
Classification Level Classification E-value
Superfamily Bacteriophage trimeric proteins domain 0.0915
Family Lactophage receptor-binding protein N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: K08A2.5a   Protein: CE33143   Gene: WBGene00003678
Sequence length 593
Comment CE33143 WBGene00003678 locus:nhr-88 nuclear hormone receptor status:Confirmed UniProt:Q9N5J5 protein_id:AAF39914.2
Sequence
MFAPSTVYTYGHHGSGTDEDDGQQVMPGMDNGDGQCMVCGDRSAGKHYGVMACYGCKGFF
RRTIRSQQTYTCRFTQKCAIDKDQRNACRYCRFQRCLTVGMEPEAIRPDRDVIGKQKNPR
KKKMKSDTNSGSIDASLPSPNGCDSPVSNNEDVILSFLLDVEDQATCGNNHITMPIGISM
MMKNDPDFDVSTLFHSQYVRNQESFPITYAVGRTASVEQLIAALRRYVLSAVHWIDALFN
LAHLTEIHDKTTLLKSVIGPFTIFNIAARTAQISDGDLICLCNKSTINRQPARHLLDTNL
VGNNFVGRVIDDLVFPTKKLALTNPEITILSALIILDPDARGLSQETSQALLGIRDRVQN
ALFNLIRDNSNNMTSVTSRFGNLLLLFPPLAKLSSLIGENVQLAKMFGIPIDSLLVELYV
DADSPELISQGSHARERSDVSTQTASLEGASASMTPDVTSSEFVKMEQNESPSSSEEPMC
IGAPATSSANAVATNLAADLLGLLPNFDATGLDLASAAAAAATSVNYSHFYGFGNLGGSL
DDSSSSGTGSVGSFAPHSAPPISNNVNPFAVHGFFDNSAPNTGVVHNQPFRFV
Download sequence
Identical sequences H2KZA1
K08A2.5a 6239.K08A2.5a.2 K08A2.7 K08A2.A K08A2.5a.1 K08A2.5a.2 NP_001022235.1.50509 K08A2.5c.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]