SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K10C3.6d from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K10C3.6d
Domain Number 1 Region: 14-36,194-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-48
Family Nuclear receptor ligand-binding domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 17-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-31
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: K10C3.6d   Protein: CE32694   Gene: WBGene00003639
Sequence length 486
Comment CE32694 WBGene00003639 locus:nhr-49 Ligand-binding domain of nuclear hormone receptors, Zinc finger, C4 type (two domains) status:Confirmed UniProt:O45666 protein_id:CAD57703.1
Sequence
MKNLQMIVIMDLVDPLAEPCAVCGDKSTGTHYGVISCNGCKGFFRRTVLRDQKFTCRFNK
RCVIDKNFRCACRYCRFQKCVQVGMKREAIQFERDPVGSPTSGASLNGTPFKKDRSPGYE
NGNSNGVGSNGMGQENMRTVPQSSSVIDALMEMEARVNQEMCNRYRRSQIFANGSGGSNG
NDTDIQQGSDSGASAFAPPNRPCTTEVDLNEISRTTLLLMVEWAKTINPFMDLSMEDKII
LLKNYAPQHLILMPAFRSPDTTRVCLFNNTYMTRDNNTDLNGFAAFKTSNITPRVLDEIV
WPMRQLQMREQEFVCLKALAFLHPEAKGLSNSSQIMIRDARNRVLKALYAFILDQMPDDA
PTRYGNILLLAPALKALTQLLIENMTLTKFFGLAEVDSLLSEFILDDINDHSTAPVSLQQ
HLSSPTTLPTNGVSPLNPAGSVGSVSSVSGITPTGMLSATLAAPLAIHPLQSQDSILNSE
QNNHML
Download sequence
Identical sequences K10C3.6d NP_871799.1.50509 K10C3.6d.1 K10C3.6d.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]