SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K11C4.3c from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K11C4.3c
Domain Number 1 Region: 85-331
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-86
Family Calponin-homology domain, CH-domain 0.00000376
Further Details:      
 
Domain Number 2 Region: 350-471
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-32
Family Spectrin repeat 0.0000666
Further Details:      
 
Domain Number 3 Region: 2186-2297
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-29
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 
Domain Number 4 Region: 1282-1435
Classification Level Classification E-value
Superfamily Spectrin repeat 4.25e-27
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 5 Region: 1070-1224
Classification Level Classification E-value
Superfamily Spectrin repeat 5.08e-27
Family Spectrin repeat 0.0000227
Further Details:      
 
Domain Number 6 Region: 1941-2073
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1599-1736
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-25
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 8 Region: 1505-1647
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-24
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 9 Region: 663-799
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-24
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 10 Region: 876-1011
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-24
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 1812-1966
Classification Level Classification E-value
Superfamily Spectrin repeat 4.6e-23
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 12 Region: 481-580
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-22
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 804-907
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-17
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 14 Region: 1706-1809
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-16
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 15 Region: 585-695
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 16 Region: 2077-2145
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000196
Family Spectrin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  K11C4.3c
Domain Number - Region: 1233-1284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0705
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: K11C4.3c   Protein: CE12112   Gene: WBGene00006803
Sequence length 2326
Comment CE12112 WBGene00006803 locus:unc-70 status:Confirmed UniProt:K11C4.3c protein_id:ADK95197.1
Sequence
MSSVDDEHHPSIEVDIPDVYESASDCEKTEDCTYLGSILKAKKSLRKTKKVASPGIYPGS
AGALSSLSNGLADENRSPTSAEVSDSVCGQKSINSVDLRFRGLRDERELVQKKTFTKWVN
SHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRN
QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQM
KTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQL
GLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMIN
RYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVL
LFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAA
RFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVA
GELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMD
DIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGY
KPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVL
SSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAE
IRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQL
LLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLR
KQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQ
EAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFR
IDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADD
IERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTAT
QRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLR
QRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSL
EQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANR
EKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQS
ELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANR
QQLYVQSIADMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLME
MEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLW
ISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGP
AFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERG
KDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYA
GLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQ
QFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQIL
EASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVA
QIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVR
DLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRK
HYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLI
SKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQHREEETAKRRGPA
HIGSPSRSTPAAETSFGAQDDGAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQ
NELSFYKDPKHRDESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEE
DMQRWLTELQVATGQAQLEEASRSQTLPAEGSATKKKGGFFSRGKK
Download sequence
Identical sequences E0AHA7
K11C4.3c K11C4.3c K11C4.3c NP_001256073.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]