SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K11E4.2 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K11E4.2
Domain Number 1 Region: 4-157
Classification Level Classification E-value
Superfamily PH domain-like 1.3e-19
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 2 Region: 197-249
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000035
Family SH2 domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: K11E4.2   Protein: CE34056   Gene: WBGene00010774
Sequence length 272
Comment CE34056 WBGene00010774 Src homology domain 2 status:Confirmed UniProt:Q21429 protein_id:CAA94158.2
Sequence
MTTAVLNDPTSSWGESAKHVNASGDRFAVKYMGYAPILQTIRERPIADRDALVRHCINTV
VSSRATHEYSVIQHEGVVGPYVSVYQLDLFLNISSFTITCFHIQDGRTHLLGRYKNNQIS
HYKYREIDGRHYLGIVMKIGRTEKRECNVFMLDNDIALNDLTTKLRSVDERRHNNALQLE
TRLRSTQEYRYTPNMLACYHGPLSHEDACRQLVLPGEFIIRDSSMRGEFAVSYKTSHGPH
DKSIVPNNNIDFFRRFQVDQSVLKHPVVRRQE
Download sequence
Identical sequences Q21429
K11E4.2 K11E4.2 K11E4.2 K11E4.2 6239.K11E4.2 NP_510295.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]