SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T04H1.5 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T04H1.5
Domain Number - Region: 254-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.091
Further Details:      
 
Domain Number - Region: 118-213
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0834
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: T04H1.5   Protein: CE13175   Gene: WBGene00011451
Sequence length 289
Comment CE13175 WBGene00011451 status:Confirmed UniProt:Q22178 protein_id:CAB01582.1
Sequence
MSDDEDDYMSAEILQGVSEQPVGIAKSRAHKRELQINSRFEESRDTFKPKRPTSHAEREK
ERRDEALAKPISHESKGFALMAKMGFKPGMTLGKQREDEIRITEPIGVDIKANRKGLGHE
VEAVQERNERVEAVMQKMKEQAAKHEELIDDYSKRRKLDANSKQLVKDIRSCRKVCEELD
HRIGKKVPSVSWFWRSYKVAQEETTSYHKKVEKEDEEYKYSNGLAAPEDPNYDFTMSTEI
LEEALSTINNYLRDGHFYCIWCGANFSSPEDMIEHCPGSTRRAHHGEDE
Download sequence
Identical sequences Q22178
6239.T04H1.5 T04H1.5 T04H1.5 T04H1.5 T04H1.5 NP_506071.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]