SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T07C5.2 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T07C5.2
Domain Number 1 Region: 93-330
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.87e-43
Family Nuclear receptor ligand-binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.23e-16
Family Nuclear receptor 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: T07C5.2   Protein: CE06380   Gene: WBGene00011565
Sequence length 334
Comment CE06380 WBGene00011565 locus:nhr-272 Ligand-binding domain of nuclear hormone receptors, Zinc finger, C4 type (two domains) status:Partially_confirmed UniProt:Q22298 protein_id:CAA90299.1
Sequence
MTNFGDCVVCGVSTHLFKYGKYLCNSCDLFFRRSMTPWSFFGDCKHNWDCYKESSNRQRL
PKCRHCRFNKCVDVGLLTVSRYTKLADLVEYLSLLDANREKTFLKLSISTDFDTNTFLDE
NPIRFIKKTSDLNFDCDEWQIMNKLSTIEMLKNLDFPKYLSSQDLRYFLKKGYFLKGILT
MAMRSYLNQEEFMSFPNGVDLFPDHAREGLHINISFLNLIRCQLVGKFIELKITREEISM
LGAIAVSNPAVPDLSSNGQKLLSCYQQLYTSSLLQYCLAKYQQNGPARFCNIMSVLNVAN
QTYDNIIKYVCLCQYYHSDMQPSKLYQSVLNQLN
Download sequence
Identical sequences Q22298
T07C5.2 T07C5.2 NP_510122.1.50509 T07C5.2 6239.T07C5.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]