SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T09A12.4b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T09A12.4b
Domain Number 1 Region: 254-479
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-29
Family Nuclear receptor ligand-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 61-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-25
Family Nuclear receptor 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: T09A12.4b   Protein: CE31062   Gene: WBGene00003656
Sequence length 526
Comment CE31062 WBGene00003656 locus:nhr-66 status:Confirmed UniProt:Q8MXH0 protein_id:AAM54167.1
Sequence
MDVIRLLDFMTASTDVFAAMDMSQKQSSPPGIFKIAKNEPSSSSNSQPGTPAMGDRRAVP
ACAICGTDSTGIHFGVDACAACSAFFRRTVVLNKDYSCNKGGKCTVVKDGSAGQKCRACR
FRKCISSGMDKNSVQHRRDAIGKYSAGVKRELSPDAEFEPSAKVSTVSEPSTSSGPSGGF
NQNVSSPAGIPRVPSTLRTTQASTCMNSACGQKSVLHELICRQNFLTEQRQLFYAGCLGD
WFRKPSSIENQTLSELTDFSSCMFHLWKIEPRLAADFMNRNRYLDPLPIVEKLKIYRNFV
IMRQSVEEPYLTWRHGGLEKRWFVMPNNTYIDFNNIAKYFENGALKDLKLDYETTTNLFL
PSFTHAMDTIGEKMKKNNITETELTILLGLVLLDPGIYGIHESTRKFLKRIRDQLIHDVY
MYYEDEMSHLYDPEIRMADIFMLVAAIKIHSIKTSENMHMLRVFDLIPADACFNQMLDVE
SVNVSPDGQKDSEAEQGPSPVSVPEAARGSYQDDDMPPVLEKNCDL
Download sequence
Identical sequences Q8MXH0
T09A12.4b T09A12.4b NP_741464.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]