SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T24A6.8 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T24A6.8
Domain Number 1 Region: 179-370
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-42
Family Nuclear receptor ligand-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 32-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-20
Family Nuclear receptor 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: T24A6.8   Protein: CE19590   Gene: WBGene00020748
Sequence length 398
Comment CE19590 WBGene00020748 locus:nhr-221 zinc finger protein status:Partially_confirmed UniProt:O61939 protein_id:AAC17795.2
Sequence
MEVVYCNTFSNVWMSENNVEIKLISTKILKPSKCMVCVRPAHGYHCDVATCKGCKTFFRR
MCLLRGEIKCSTSGDCYDLEKRNSPLLRCRPCRFKRCLLVGMNPKALIIDGSNILGEKQV
HFNEQQIQGTIDVLSHLEAKTEQFSKCAYNPDWTNIRLKDLILSPSKLSMSDKVGTFPDW
PLCPNYEFPDQIVHRDIQSFSPHRKQWRFSNLMTAVEYTKTFSFFHDLSFQDQINLLKHV
VIGLANFNTTYYTLKNKFDDLRQPDGTQRPGVNEPHYCAHTVPFGPMKRIKIQFNEFLLL
KILFVCNPAVPNLSKHAQFVIEKERHHYSNILLKYCLQNYSYGPTRFVELIEIFGVLHRQ
QKLMNDLYIYVLSPLLLKLPKEFSVPLIEEIVLLYALS
Download sequence
Identical sequences O61939
T24A6.8 T24A6.8 NP_503987.1.50509 6239.T24A6.8 T24A6.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]