SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T27B7.4b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T27B7.4b
Domain Number 1 Region: 90-318
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.33e-39
Family Nuclear receptor ligand-binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: T27B7.4b   Protein: CE43382   Gene: WBGene00003705
Sequence length 322
Comment CE43382 WBGene00003705 locus:nhr-115 status:Confirmed UniProt:B7E2K2 protein_id:ACJ65171.1
Sequence
MDASKFQYDRDAISAIKHPKIFPSVSYYVGRPEFLMFSDSNVTSQKTFIDVQNLVFEVSR
YLDHGCETPIYAENQLKKLTLGFKLMQFDYQNVKFFDKIGKAEFIDIIEYYFLTVAKWIA
HFDEFRKLDQSLQIKLLQAIWHVWSKIHKCASTAFYRKSNPNAKPTQKILRNVCMDRMHV
HKLDTSWMSDYPTEHVTRFMLTHHVYDFKIVESLLKLDPTDVELTFMFAQLCFEYAGKRF
QGEILKITDHFQQVLSNDLHHYYITDQRRERYFQRLTDLMKVNNLIQRSIWETRPHRELG
RVFEISKLEFSHPEMFDDSGFC
Download sequence
Identical sequences B7E2K2
T27B7.4b T27B7.4b NP_001256015.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]