SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W01D2.2b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W01D2.2b
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.07e-29
Family Nuclear receptor 0.00026
Further Details:      
 
Domain Number 2 Region: 173-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.13e-24
Family Nuclear receptor ligand-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: W01D2.2b   Protein: CE20125   Gene: WBGene00003651
Sequence length 415
Comment CE20125 WBGene00003651 locus:nhr-61 Zinc finger, C4 type (two domains) status:Confirmed UniProt:O62389 protein_id:CAB05637.1
Sequence
MIVDSISSSTASTSSSSPTRGTPIRKSLQCAVCGDVALGKHYGVNACNGCKGFFRRSIWK
NRTYACRHGGKCLVAKEQRNACRSCRLTRCLDVGMNPRAVQGDTVEDPEWDEEAMPETLS
ISTQTDALKVKKKSHTSLFTLDIKKEQIIDNLRAIYARTDPEEFWKLTYPGTYDFRYAFH
NTKVVSPRTPLTPTAERIATLNDVVADFRRAFVLFVDILKSIDQLRDVQEDDKMKIAKSR
FAAFYWWLCSTWSAKAGCNGVCYSNGSYHPASISDMPKSEGKHGVRIEYVDYSGVSQKSL
ENLVEPLRRMELSDEERIVGAVMVILADPVPNVSTKTEKILAEARDFYLELLGYCIKLPE
EQQGIRVSTMVLLLASIMELVHLTTDNIQLSDVLHVIDLGDWSQELRDHRYRRQF
Download sequence
Identical sequences NP_001022382.1.50509 W01D2.2a.2 6239.W01D2.2b W01D2.2b W01D2.2b.1 W01D2.2b.2 W01D2.2b.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]