SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W04D2.1a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W04D2.1a
Domain Number 1 Region: 24-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-89
Family Calponin-homology domain, CH-domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 297-420
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-32
Family Spectrin repeat 0.00000492
Further Details:      
 
Domain Number 3 Region: 535-656
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-24
Family Spectrin repeat 0.0000247
Further Details:      
 
Domain Number 4 Region: 421-530
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-23
Family Spectrin repeat 0.000011
Further Details:      
 
Domain Number 5 Region: 659-771
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-17
Family Spectrin repeat 0.0000355
Further Details:      
 
Domain Number 6 Region: 763-883
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000416
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: W04D2.1a   Protein: CE06539   Gene: WBGene00000228
Sequence length 920
Comment CE06539 WBGene00000228 locus:atn-1 alpha-actinin status:Confirmed UniProt:Q23158 protein_id:CAA99941.1
Sequence
MVDYYQQPPSYHQPGYDYTQQEEEWDREGLLDPAWEKQQKKTFTAWCNSHLRKAGTSIDT
IEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEE
IVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWK
DGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDVSRHPDEK
STMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVN
QENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIE
DKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRL
ERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQD
RVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDS
LYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSIN
QIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNN
ERLRTIFAEKANQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRSIQRNVLGYKPNLDEL
ERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQI
AEFRASFSHFDKERAGLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPF
EAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSRE
PGAPPRSFDYVTFSRSLYSQ
Download sequence
Identical sequences Q23158
6239.W04D2.1a W04D2.1a W04D2.1a W04D2.1a NP_506127.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]