SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W05B5.3b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W05B5.3b
Domain Number 1 Region: 33-239
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.28e-17
Family Nuclear receptor ligand-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: W05B5.3b   Protein: CE20150   Gene: WBGene00003675
Sequence length 336
Comment CE20150 WBGene00003675 locus:nhr-85 status:Confirmed UniProt:Q9XUK7 protein_id:CAH04734.1
Sequence
MSRDAVRFGRVPKREKARMFEEMQKTNVQSQRDQIAIQYENLTEVMHKINQAFGTLQATL
EKCTGPIYTDRCPITSNFIVIPLKAAIDFANSIPAFLSITQTQRVHLLQNSVFDVMLLAS
ASASTSQHFPPGGLTYDQSSANPIIPQAIQSISARIRQLPPQTVPILTAIAVCQADLLPE
SQQPMLLAERLWCVLGKLGGIQSLATAPSLLADVRTLRQWHSDRLRQMSQISQHFSQNLL
IAPVAAAAPVLLPPAFLSPPASATSTSSSSVKSEFIERHPSIASLLERPRRISSSGAQEP
LNLSLPHVRHQVKRDVDSDEQLEEMKVSPVPTTLSE
Download sequence
Identical sequences NP_001021668.1.50509 W05B5.3b W05B5.3b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]