SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y46H3D.7 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y46H3D.7
Domain Number 1 Region: 87-331
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-30
Family Nuclear receptor ligand-binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-23
Family Nuclear receptor 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: Y46H3D.7   Protein: CE24324   Gene: WBGene00021611
Sequence length 333
Comment CE24324 WBGene00021611 locus:nhr-238 zinc finger protein status:Confirmed UniProt:Q966B7 protein_id:AAK72310.1
Sequence
MMAKSVFCGVCEHSADVFHFGAICCEACAAFFRRLVSRSKTPTAICSGNCDLRNKIIRKL
CSSCRYQKCLQIGMKESLVKSKKQKTSSSEKTILEELNEAYQNLLDLRKETFRNQEAKLT
YFEEMDDVCSVDLSLVVETLVRTFYKMAPMEDDQQRLLVKNFLVEFMLMDMSFRSIDSNV
IILANGNYVDVKNLDEHFQSTKIVSDESKAAEAKLYLKSYWEMAESQLVGRFQELRVDRN
EHLLLCALLYWDFGLENQSEESSEICLKLRSRIFKELSNYERKQSSTEKQFSRTGDLILI
LQIIDKQMVSMYEYKTVSIIYDLCAKNCPLFRI
Download sequence
Identical sequences Q966B7
Y46H3D.7 Y46H3D.7.1 Y46H3D.7.1 Y46H3D.7.2 NP_503461.1.50509 6239.Y46H3D.7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]