SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y47D3A.23b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y47D3A.23b
Domain Number 1 Region: 10-184
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.04e-26
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000602
Further Details:      
 
Domain Number 2 Region: 200-319
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.43e-23
Family Ricin B-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: Y47D3A.23b   Protein: CE37859   Gene: WBGene00012934
Sequence length 325
Comment CE37859 WBGene00012934 locus:gly-9 status:Confirmed UniProt:Q9U2C4 protein_id:CAI46621.1
Sequence
MIDSISDNTLAYHGDWSLSTGGFSWALHFTWEGLSEEEQKRRTKPTDYIRSPTMAGGLLA
ANREYFFEVGGYDEEMDIWGGENLEISFRAWMCGGSIEFIPCSHVGHIFRAGHPYNMTGR
NNNKDVHGTNSKRLAEVWMDDYKRLYYMHREDLRTKDVGDLTARHELRKRLNCKPFKWFL
DNIAKGKFIMDEDVVAYGALHTVVSGTRMCTDTLQRDEKMSQLLGVFHCQGKGSSPQLMS
LSKEGNLRRENTCASEENGNIRMKTCSKKAQFNERWAYENKMIRNLKSGKCMSTANLKPG
DNAIVVECDEKDEHQKWNFIDPAKA
Download sequence
Identical sequences Y47D3A.23b NP_001022877.1.50509 Y47D3A.23b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]