SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y53F4B.19 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y53F4B.19
Domain Number 1 Region: 42-187
Classification Level Classification E-value
Superfamily PapD-like 1.88e-21
Family MSP-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: Y53F4B.19   Protein: CE22409   Gene: WBGene00013165
Sequence length 338
Comment CE22409 WBGene00013165 status:Partially_confirmed UniProt:Q9NAA1 protein_id:CAB70108.2
Sequence
MSVVSERDVDEYSKQKPETYVLQVSERERKEKYERKNPPIPLDNEYNYQDVTPSPFPFHI
DAPSLVFMGRLGEEPISAHFTLTNRTCKPFWFKIKVSSRELFKVRPTNGKLENSERVVIR
VIFYPNVRVPKPFCEYLHVYALFAGLGDRTAYEAFNRLDRQRTLPPKRLFTEFVWHPNIG
MTQAYENGKLMEMMRAKQKLLDYRKDENDKIKTFQVDFNNVIFDHRNRVLDRMLKANVVE
KEKLLYMPTPNLNLYMQNLRNQKNRSKLAVLLERRGDAFKGVQNLYAEEVLAKRTGDKMF
EKYKKKKGTKGYQSLDAKLYRPVKVVRNTKNKKKKGKK
Download sequence
Identical sequences Q9NAA1
Y53F4B.19 Y53F4B.19 6239.Y53F4B.19 NP_497104.2.50509 Y53F4B.19 Y53F4B.19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]