SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y57G11C.5b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y57G11C.5b
Domain Number 1 Region: 190-393
Classification Level Classification E-value
Superfamily Serpins 1.44e-16
Family Serpins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: Y57G11C.5b   Protein: CE40536   Gene: WBGene00013303
Sequence length 512
Comment CE40536 WBGene00013303 status:Partially_confirmed UniProt:D3YTA3 protein_id:CBK19507.1
Sequence
MLSMVTGRTGSESNSNTSDGEKTILRWTTACLTTTCPIFSRNPQFNMIYCPVPSLLMYVI
ITLASENAMTKTLHRLFELTDSDVDEIREMAQKLAELQHPKHFYCFIRFLVDEQETTTVS
KELMIKSNDVAFQQVFASFRPSRITKFLNSLTFSPVSLNRPSLLTTNGYGSAGLNATWIG
KTRKAGLNRFACTYHKKKNEEFFEIRTAYRTINMEQFQVFEIPFKFGLSSACFGSLLILR
PHLIGSLPYANRQLTTQSLSKMLDELYTAQWITEGRLLLPQFSVDSCHDLWKNLMRHGVQ
PDLGQSQKAPPMASLWHWAHLRVGSEGIRGNVMTKKNGAKLTASQKALQNTFHNRVDSDS
LLKKHQSYAARIDSPFTYLVMVQGIPIFTGSYFGAPPPKSTEIFINAPERIRHHRTYITK
HRRYPKETRKQKLMRRVRKSEDREKEKDKKRARKEQKNQKVENLEQSTTASSTSSLSSPE
ITVSKKPEIKNDDKSKSKGWRHLANRIFKRKN
Download sequence
Identical sequences D3YTA3
Y57G11C.5b 6239.Y57G11C.5 Y57G11C.5b NP_001255827.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]