SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK1151.1e from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1151.1e
Domain Number 1 Region: 13-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-81
Family Calponin-homology domain, CH-domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 1370-1578
Classification Level Classification E-value
Superfamily Plakin repeat 6.15e-28
Family Plakin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 2751-2919
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-27
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 2353-2517
Classification Level Classification E-value
Superfamily Plakin repeat 1.4e-24
Family Plakin repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 2103-2166,2223-2305
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-22
Family Plakin repeat 0.0061
Further Details:      
 
Domain Number 6 Region: 1702-1844
Classification Level Classification E-value
Superfamily Plakin repeat 7.72e-22
Family Plakin repeat 0.0082
Further Details:      
 
Domain Number 7 Region: 2598-2779
Classification Level Classification E-value
Superfamily Plakin repeat 2.88e-18
Family Plakin repeat 0.0097
Further Details:      
 
Domain Number 8 Region: 1808-1945,1989-2010
Classification Level Classification E-value
Superfamily Plakin repeat 5.82e-18
Family Plakin repeat 0.004
Further Details:      
 
Domain Number 9 Region: 2895-3045
Classification Level Classification E-value
Superfamily Plakin repeat 5.89e-18
Family Plakin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1061-1180,1213-1239
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 11 Region: 574-703,764-788
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 12 Region: 1606-1719
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000615
Family Plakin repeat 0.02
Further Details:      
 
Domain Number 13 Region: 3137-3233
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000275
Family Plakin repeat 0.0046
Further Details:      
 
Domain Number 14 Region: 487-615
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000396
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 15 Region: 874-967
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000353
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 16 Region: 425-518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  ZK1151.1e
Domain Number - Region: 697-754
Classification Level Classification E-value
Superfamily SH3-domain 0.00131
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK1151.1e   Protein: CE36461   Gene: WBGene00006876
Sequence length 3323
Comment CE36461 WBGene00006876 locus:vab-10 status:Partially_confirmed UniProt:Q6BEQ4 protein_id:CAH04741.1
Sequence
MVGERYRSHHAVDPSDAQEKEVLDHYELNREKYNDERDNVQKKTFTKWVNKHLSKTDHKI
DDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPE
DIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATS
ARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTE
RLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRGNSNDLL
SRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFED
VEELKSMQHPEANDFYKQVYGLHQRRTTYLDRLTNQILVRLGVRTDSLHKENQQRLENMR
KTSFSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDECIAR
QAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESI
EVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYL
RQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNRTDFSLE
EGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQRGERIPHPIKVTALCDYSDENV
TIKAGDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLK
KLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSELDPND
PLALRLREELRRTNEHFWNLLNASQKPPEPDWASQYDQKMAELLKKLEEAWRELNDAVGK
PISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDD
LWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITLNSFDDLPAALDKLRGHHSQLLEIN
MVLKVSKLGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEGHHPDVDAIEDEVQKLN
VRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETINRLRKPEELRPEQYQ
QQLDMLIAEYTNLQEHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEF
RRTKPQPKNGSQIVTEELELLNRRFAQLSSLILERRNTMQVLIQNWKRQKQEEEDRRRAE
EEEKRRAFEAARLKALEDAERLRREREDAEARRRAKDDADRARRMAEDAERARREAEEAE
RRRREEEERRRREAEDRKRRQDEEDRRRREEEERRRREEEEKRRKKPDFDLKIQKPTMNI
EPVVTSAGDEWEIVDPIGDRAKISEVEDEMQTFAEETITNTQFYEMEGNLNKKTGEVLTF
IEAIRQGNLTAAGQFFDIPSASVMSLEEAAKYGLVEQDLPTVLNTTWGIHHPETRQPITL
SEAIRIGLYDSNIRQFRDIHTGEILSQSDLMSKGIANWETVLKLIKEKIMKLPPTSLANA
LEKRMVDPQTGVFKGRTTDMELQLWAAIYHGYLSIENPEHVTTIGTSLTDAIENGFINAN
NAEFNDRNSNDSFKLRDAVSKRTGLINNDVVEIVQMTDDEKKRVPLGAALVRNVIGVKDG
KYTNLASRQSMSLKEAHQDGLIGKALTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIV
AGLIDAEVRHIVDPNENDVISISEAMERGLLLPNGKIVLEKDEKEFTIPEAVHEGLLTKR
VRHSIFNIRGIRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITDDRAKNLIEV
ALHELLTTPVGIKNDRGAYELNLVRAVSSGIIDPVKGVFFNKNTKHELSTKEAYEQGFIT
LRGALKVFGLLNVPPALVTPAKKLDRTRRIGRPGQEGGADGNHVTVTLQDAMRQGLVGNQ
RYVHGKVDLSLEEALNRGLLDPNSQWIMPDQSKGDGPTIEEKTTETMTETGQQLAPKYFP
DKNIEESVTTVKRVRTTETTALGGPGGVSVYRSIAGGKGALEVPSRGYHIYEAERKGLID
LTNGKISAPNVDRVLSFAEGIELGIIDATTIQVSTGGRSVSVKEALEKKIMESDGSVNGR
NIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDT
QQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYF
DKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKVQTRTAVAKKEALSSGLPLSDY
SLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAI
REEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLDLGSGSYTRP
SGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGGGDSTSF
SQGLTSGHLVSSGSSRPTSGNQSRLVEQRLQLTPFAPNGGAGRSRDGRHELVDLGGGQQV
QVKVVRGEGGVEKGEYTDPKSGMKFTIQMHGDPVVTETKTSVKSTSQVHSVELEPHAEFV
GIDRVRDKRNNHVYSLEEARRLGLAKVDKKGKQMTRSYQAFRSNIDNAVNNGVVDSHNQK
ISLENAIHARIIDIRNLSYHHPTHGSVDLKTAASQGLVDVTLSEVLPKGIIHPGTGERID
IKRGIELRIIDAATGKVRDPRDNKTITWIDILKPVYQAIASEGVFDPTKGHHVPVTTALN
DGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVR
ERLIDPKNRTIQLSRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQN
VFTDPDTGRQMSIAQAIQEGFIDTGSVQGIEGNDESNLFNVLQSSDFDETSGRIYDKKSS
LHLTFNDAVRRGVIDGDSLLHLQATGDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVK
SGRLTVIASPSEAVQAVTEGVKRRDAEGYKFRISEYDDSQAQRQSVPKFRETVTVSKLTP
QYNEPGLSVRMRQSTTSIGDRASKFLEDPSQLAEIQQDFLSSLEAAQFDTDEKVIEHPHT
RQRVSVREAAETGLLDVQTGEIVNPDNGRRFSIPRAVHMKLVGGDAAKRIMEQLNMPVEE
VAYATQTITSSTHRAPSPVFATASVSQPSGGATTTREFTRTINWHGQPSELRNSQTDPLA
AYTTVSSNVTESTEDAPAWARKQ
Download sequence
Identical sequences G5ECG8
ZK1151.1e NP_001021857.1.50509 ZK1151.1e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]