SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK418.11 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK418.11
Domain Number 1 Region: 70-300
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.35e-36
Family Nuclear receptor ligand-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK418.11   Protein: CE38671   Gene: WBGene00044354
Sequence length 301
Comment CE38671 WBGene00044354 status:Predicted UniProt:Q4TTC5 protein_id:AAY43978.1
Sequence
MVFRRAVNSKKPPKSCNPGECPQRCLIAEFKQKCPRRKFYECINANMRIASFDIYSNKFK
LIQDLMSSDAERQKIFYTCHVTADLNFEEMLDPKLVKLCKKEMDVVFTSHDWVAIEAFTT
LEFMKRIHFVKMLNADEANLILKHSFFTLSIVFMAGRSYFDKKEFMVFPGKVDVFPEEIS
DQYPLDLLNRIRCRLISKFIELRITTEEFLLMVITYFCQISSMLVGSSAKRIIEEYLSIY
LSTLGINCNFRFQKHGRIRYLNIIFLSQLIEKTIEDLAQLFTLFQLNQPTLPLRKLVKES
L
Download sequence
Identical sequences Q4TTC5
ZK418.11 ZK418.11 NP_001022997.1.50509 6239.ZK418.11 ZK418.11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]