SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK488.4 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK488.4
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-18
Family Nuclear receptor 0.0031
Further Details:      
 
Domain Number 2 Region: 162-340
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.82e-16
Family Nuclear receptor ligand-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK488.4   Protein: CE15357   Gene: WBGene00022756
Sequence length 343
Comment CE15357 WBGene00022756 locus:nhr-251 zinc finger protein status:Partially_confirmed UniProt:O17020 protein_id:AAB69951.1
Sequence
MACASFFRRTVSFGIRFLCKEGNRCPISQEIRFFCRSCRYDKCISVGMNRGQVQQKRDDN
NVPKYVLDSRRLGIQEIVRGYTTSRTVPSEPAEPISPGSTGSTGSTRSSSPETSPAEPSK
KSEFSIILNTYPDDLLQYYVKQVEMSMIHKQLGLLKNTLLVKSVDELVDISETLNDLSME
ACMNCPGVDILRQRDVEVILKSFHFANVWMDSIWAYSRHNESIVNKFFENNGPLSMFINQ
IKSTLGSSLSQLTFNIYEFSALKAFCVWKLSYHDSTISINIMAEEQYIGICSALRKHYEA
TTNMTDVDIAMRIAEITLQIVPATTIYQDMIRFYQQNGLIDNL
Download sequence
Identical sequences O17020
ZK488.4 ZK488.4 6239.ZK488.4 ZK488.4 ZK488.4 NP_503258.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]